Lineage for d2b0og2 (2b0o G:546-681)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944478Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1944479Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1944620Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 1944621Protein automated matches [191267] (5 species)
    not a true protein
  7. 1944634Species Human (Homo sapiens) [TaxId:9606] [189837] (18 PDB entries)
  8. 1944662Domain d2b0og2: 2b0o G:546-681 [203524]
    Other proteins in same PDB: d2b0oe1, d2b0of1, d2b0og1, d2b0oh1
    automated match to d1dcqa1
    complexed with zn

Details for d2b0og2

PDB Entry: 2b0o (more details), 2.06 Å

PDB Description: Crystal structure of UPLC1 GAP domain
PDB Compounds: (G:) uplc1

SCOPe Domain Sequences for d2b0og2:

Sequence, based on SEQRES records: (download)

>d2b0og2 d.211.1.0 (G:546-681) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pepqrlwtaicnrdllsvleafangqdfgqplpgpdaqapeelvlhlavkvanqaslplv
dfiiqngghldakaadgntalhyaalynqpdclklllkgralvgtvneagetaldiarkk
hhkeceelleqaqagt

Sequence, based on observed residues (ATOM records): (download)

>d2b0og2 d.211.1.0 (G:546-681) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pepqrlwtaicnrdllsvleafangqdfgqplpgeelvlhlavkvanqaslplvdfiiqn
gghldakaadgntalhyaalynqpdclklllkgralvgtvneagetaldiarkkhhkece
elleqaqagt

SCOPe Domain Coordinates for d2b0og2:

Click to download the PDB-style file with coordinates for d2b0og2.
(The format of our PDB-style files is described here.)

Timeline for d2b0og2: