SCOPe 2.05: Domain d2aytb1: 2ayt B:2-121

Lineage for d2aytb1 (2ayt B:2-121)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [225093] (1 PDB entry)

8. Domain d2aytb1: 2ayt B:2-121 [203517]
   automated match to d1a8la1
   complexed with gol, so4

Details for d2aytb1

PDB Entry: 2ayt, 2.4 Å

PDB Description: The crystal structure of a protein disulfide oxidoreductase from aquifex aeolicus

PDB Compounds: (B:) glutaredoxin-like protein

SCOPe Domain Sequences for d2aytb1:

Sequence; same for both SEQRES and ATOM records:

>d2aytb1 c.47.1.0 (B:2-121) automated matches {Aquifex aeolicus [TaxId: 63363]}
llnldvrmqlkelaqkefkepvsiklfsqaigcescqtaeellketvevigeavgqdkik
ldiyspfthkeetekygvdrvptiviegdkdygiryiglpaglefttlingifhvsqrkp

Timeline for d2aytb1:

• d2aytb1 first appeared in SCOPe 2.03
  
• d2aytb1 appears in SCOPe 2.04
  
• d2aytb1 appears in SCOPe 2.06
  
• d2aytb1 appears in the current release, SCOPe 2.08