Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [225093] (1 PDB entry) |
Domain d2aytb1: 2ayt B:2-121 [203517] automated match to d1a8la1 complexed with gol, so4 |
PDB Entry: 2ayt (more details), 2.4 Å
SCOPe Domain Sequences for d2aytb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aytb1 c.47.1.0 (B:2-121) automated matches {Aquifex aeolicus [TaxId: 63363]} llnldvrmqlkelaqkefkepvsiklfsqaigcescqtaeellketvevigeavgqdkik ldiyspfthkeetekygvdrvptiviegdkdygiryiglpaglefttlingifhvsqrkp
Timeline for d2aytb1: