| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
| Protein automated matches [226859] (38 species) not a true protein |
| Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [225014] (1 PDB entry) |
| Domain d2awpa1: 2awp A:1-83 [203505] Other proteins in same PDB: d2awpa2, d2awpb2 automated match to d1ma1a1 complexed with cl, unx |
PDB Entry: 2awp (more details), 2 Å
SCOPe Domain Sequences for d2awpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2awpa1 a.2.11.0 (A:1-83) automated matches {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}
maiilpklkyalnalsphiseetlnfhynkhhagyvnklnglikdtpfatkslveimkes
tgaifnnaaqiwnhsfywdsmgp
Timeline for d2awpa1: