SCOPe 2.03: Domain d2awga_: 2awg A:

Lineage for d2awga_ (2awg A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225017] (6 PDB entries)

8. Domain d2awga_: 2awg A: [203504]
   automated match to d3ni6b_

Details for d2awga_

PDB Entry: 2awg, 1.6 Å

PDB Description: Structure of the PPIase domain of the Human FK506-binding protein 8

PDB Compounds: (A:) 38 kDa FK-506 binding protein

SCOPe Domain Sequences for d2awga_:

Sequence; same for both SEQRES and ATOM records:

>d2awga_ d.26.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gspeewldilgngllrkktlvpgppgssrpvkgqvvtvhlqtslengtrvqeepelvftl
gdcdviqaldlsvplmdvgetamvtadskycygpqgrspyipphaalclevtlktavd

Timeline for d2awga_:

• d2awga_ is new in SCOPe 2.03-stable
  
• d2awga_ appears in SCOPe 2.04
  
• d2awga_ appears in the current release, SCOPe 2.08, called d2awga1