Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries) |
Domain d2awga1: 2awg A:90-205 [203504] Other proteins in same PDB: d2awga2 automated match to d3ni6b_ |
PDB Entry: 2awg (more details), 1.6 Å
SCOPe Domain Sequences for d2awga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2awga1 d.26.1.0 (A:90-205) automated matches {Human (Homo sapiens) [TaxId: 9606]} peewldilgngllrkktlvpgppgssrpvkgqvvtvhlqtslengtrvqeepelvftlgd cdviqaldlsvplmdvgetamvtadskycygpqgrspyipphaalclevtlktavd
Timeline for d2awga1: