Lineage for d2aw5c1 (2aw5 C:15-269)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610013Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1610014Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1610318Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 1610319Protein automated matches [226864] (21 species)
    not a true protein
  7. 1610385Species Human (Homo sapiens) [TaxId:9606] [225016] (2 PDB entries)
  8. 1610388Domain d2aw5c1: 2aw5 C:15-269 [203502]
    Other proteins in same PDB: d2aw5a2, d2aw5b2, d2aw5c2
    automated match to d1gq2a2

Details for d2aw5c1

PDB Entry: 2aw5 (more details), 2.5 Å

PDB Description: Crystal structure of a human malic enzyme
PDB Compounds: (C:) NADP-dependent malic enzyme

SCOPe Domain Sequences for d2aw5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aw5c1 c.58.1.0 (C:15-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvknfehlnsdfdryll
lmdlqdrneklfyrvltsdiekfmpivytptvglacqqyslvfrkprglfitihdrghia
svlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytacggmnpqeclpvild
vgteneellkdplyiglrqrrvrgseyddfldefmeavsskygmncliqfedfanvnafr
llnkyrnqyctfndd

SCOPe Domain Coordinates for d2aw5c1:

Click to download the PDB-style file with coordinates for d2aw5c1.
(The format of our PDB-style files is described here.)

Timeline for d2aw5c1: