![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (40 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225016] (9 PDB entries) |
![]() | Domain d2aw5b1: 2aw5 B:15-269 [203500] Other proteins in same PDB: d2aw5a2, d2aw5b2, d2aw5c2 automated match to d1gq2a2 |
PDB Entry: 2aw5 (more details), 2.5 Å
SCOPe Domain Sequences for d2aw5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aw5b1 c.58.1.0 (B:15-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} gylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvknfehlnsdfdryll lmdlqdrneklfyrvltsdiekfmpivytptvglacqqyslvfrkprglfitihdrghia svlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytacggmnpqeclpvild vgteneellkdplyiglrqrrvrgseyddfldefmeavsskygmncliqfedfanvnafr llnkyrnqyctfndd
Timeline for d2aw5b1:
![]() Domains from other chains: (mouse over for more information) d2aw5a1, d2aw5a2, d2aw5c1, d2aw5c2 |