Lineage for d2aw5a1 (2aw5 A:15-269)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127441Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2127442Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2127755Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2127756Protein automated matches [226864] (29 species)
    not a true protein
  7. 2127835Species Human (Homo sapiens) [TaxId:9606] [225016] (3 PDB entries)
  8. 2127836Domain d2aw5a1: 2aw5 A:15-269 [203498]
    Other proteins in same PDB: d2aw5a2, d2aw5b2, d2aw5c2
    automated match to d1gq2a2

Details for d2aw5a1

PDB Entry: 2aw5 (more details), 2.5 Å

PDB Description: Crystal structure of a human malic enzyme
PDB Compounds: (A:) NADP-dependent malic enzyme

SCOPe Domain Sequences for d2aw5a1:

Sequence, based on SEQRES records: (download)

>d2aw5a1 c.58.1.0 (A:15-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvknfehlnsdfdryll
lmdlqdrneklfyrvltsdiekfmpivytptvglacqqyslvfrkprglfitihdrghia
svlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytacggmnpqeclpvild
vgteneellkdplyiglrqrrvrgseyddfldefmeavsskygmncliqfedfanvnafr
llnkyrnqyctfndd

Sequence, based on observed residues (ATOM records): (download)

>d2aw5a1 c.58.1.0 (A:15-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gylltrnphlnkdlaftleerqqlnihgllppsfnsqeiqvlrvvknfehlnsdfdryll
lmdlqdrneklfyrvltsiekfmpivytptvglacqqyslvfrkprglfitihdrghias
vlnawpedvikaivvtdgerilglgdlgcngmgipvgklalytacggmnpqeclpvildv
gteneellkdplyiglrqrrvrgseyddfldefmeavsskygmncliqfedfanvnafrl
lnkyrnqyctfndd

SCOPe Domain Coordinates for d2aw5a1:

Click to download the PDB-style file with coordinates for d2aw5a1.
(The format of our PDB-style files is described here.)

Timeline for d2aw5a1: