| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Achromobacter cycloclastes [TaxId:223] [225121] (13 PDB entries) |
| Domain d2avff1: 2avf F:6-159 [203496] Other proteins in same PDB: d2avfd3, d2avff3 automated match to d1bq5a1 complexed with cl, cu |
PDB Entry: 2avf (more details), 2.6 Å
SCOPe Domain Sequences for d2avff1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avff1 b.6.1.0 (F:6-159) automated matches {Achromobacter cycloclastes [TaxId: 223]}
pvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfn
gsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfk
atkpgvfvyhcapegmvpwhvtsgmngaimvlpr
Timeline for d2avff1: