SCOPe 2.08: Domain d2avfa2: 2avf A:160-325

Lineage for d2avfa2 (2avf A:160-325)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Achromobacter cycloclastes [TaxId:223] [225121] (13 PDB entries)

8. Domain d2avfa2: 2avf A:160-325 [203487]
   Other proteins in same PDB: d2avfd3, d2avff3
   automated match to d1bq5a2
   complexed with cl, cu

Details for d2avfa2

PDB Entry: 2avf, 2.6 Å

PDB Description: Crystal Structure of C-terminal Desundecapeptide Nitrite Reductase from Achromobacter cycloclastes

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2avfa2:

Sequence; same for both SEQRES and ATOM records:

>d2avfa2 b.6.1.0 (A:160-325) automated matches {Achromobacter cycloclastes [TaxId: 223]}
dglkdekgqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthiv
fngavgaltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqe
twlipggtagaafytfrqpgvyayvnhnlieafelgaaghfkvtge

Timeline for d2avfa2:

• d2avfa2 first appeared in SCOPe 2.03
  
• d2avfa2 appears in SCOPe 2.07