| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
| Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
| Protein automated matches [190202] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries) |
| Domain d2augb1: 2aug B:433-537 [203485] Other proteins in same PDB: d2augb2 automated match to d2qmsa_ |
PDB Entry: 2aug (more details), 2.3 Å
SCOPe Domain Sequences for d2augb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2augb1 d.93.1.1 (B:433-537) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ihrsqpwfhhkisrdeaqrliiqqglvdgvflvrdsqsnpktfvlsmshgqkikhfqiip
veddgemfhtlddghtrftdliqlvefyqlnkgvlpcklkhycar
Timeline for d2augb1: