SCOPe 2.08: Domain d2augb1: 2aug B:433-537

Lineage for d2augb1 (2aug B:433-537)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein automated matches [190202] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries)

8. Domain d2augb1: 2aug B:433-537 [203485]
   Other proteins in same PDB: d2augb2
   automated match to d2qmsa_

Details for d2augb1

PDB Entry: 2aug, 2.3 Å

PDB Description: Crystal structure of the Grb14 SH2 domain

PDB Compounds: (B:) Growth factor receptor-bound protein 14

SCOPe Domain Sequences for d2augb1:

Sequence; same for both SEQRES and ATOM records:

>d2augb1 d.93.1.1 (B:433-537) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ihrsqpwfhhkisrdeaqrliiqqglvdgvflvrdsqsnpktfvlsmshgqkikhfqiip
veddgemfhtlddghtrftdliqlvefyqlnkgvlpcklkhycar

Timeline for d2augb1:

• d2augb1 first appeared in SCOPe 2.03, called d2augb_
  
• d2augb1 appears in SCOPe 2.07