![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.2: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57774] (2 families) ![]() automatically mapped to Pfam PF05191 |
![]() | Family g.41.2.0: automated matches [227167] (1 protein) not a true family |
![]() | Protein automated matches [226876] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225040] (3 PDB entries) |
![]() | Domain d2ar7a2: 2ar7 A:126-161 [203481] Other proteins in same PDB: d2ar7a1, d2ar7a3, d2ar7b1, d2ar7b3 automated match to d2ak3a2 |
PDB Entry: 2ar7 (more details), 2.15 Å
SCOPe Domain Sequences for d2ar7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ar7a2 g.41.2.0 (A:126-161) automated matches {Human (Homo sapiens) [TaxId: 9606]} rwihppsgrvynldfnpphvhgiddvtgeplvqqed
Timeline for d2ar7a2: