Lineage for d2ar7a1 (2ar7 A:4-125,A:162-223)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128604Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)
  8. 2128649Domain d2ar7a1: 2ar7 A:4-125,A:162-223 [203480]
    Other proteins in same PDB: d2ar7a2, d2ar7a3, d2ar7b2, d2ar7b3
    automated match to d2ak3a1

Details for d2ar7a1

PDB Entry: 2ar7 (more details), 2.15 Å

PDB Description: Crystal structure of human adenylate kinase 4, AK4
PDB Compounds: (A:) Adenylate kinase 4

SCOPe Domain Sequences for d2ar7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ar7a1 c.37.1.0 (A:4-125,A:162-223) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kllravilgppgsgkgtvcqriaqnfglqhlssghflrenikastevgemakqyieksll
vpdhvitrlmmselenrrgqhwlldgfprtlgqaealdkicevdlvislnipfetlkdrl
srXdkpeavaarlrqykdvakpvielyksrgvlhqfsgtetnkiwpyvytlfsnkitpiq
skeay

SCOPe Domain Coordinates for d2ar7a1:

Click to download the PDB-style file with coordinates for d2ar7a1.
(The format of our PDB-style files is described here.)

Timeline for d2ar7a1: