SCOPe 2.03: Domain d2ania_: 2ani A:

Lineage for d2ania_ (2ani A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (8 species)
   not a true protein

7. Species Chlamydia trachomatis [TaxId:813] [225098] (1 PDB entry)

8. Domain d2ania_: 2ani A: [203477]
   automated match to d1syya_
   complexed with fe, pb; mutant

Details for d2ania_

PDB Entry: 2ani, 2 Å

PDB Description: crystal structure of the f127y mutant of ribonucleotide reductase r2 from chlamydia trachomatis

PDB Compounds: (A:) Ribonucleoside-diphosphate reductase beta subunit

SCOPe Domain Sequences for d2ania_:

Sequence; same for both SEQRES and ATOM records:

>d2ania_ a.25.1.2 (A:) automated matches {Chlamydia trachomatis [TaxId: 813]}
qadildgkqkrvnlnskrlvncnqvdvnqlvpikykwawehylngcannwlpteipmgkd
ielwksdrlsederrvillnlgffstaeslvgnnivlaifkhvtnpearqyllrqafeea
vhthtylyiceslgldekeifnayneraaikakddfqmeitgkvldpnfrtdsveglqef
vknlvgyyiimegiffysgfvmilsfhrqnkmigigeqyqyilrdetihlnfgidlingi
keenpeiwtpelqqeivelikravdleieyaqdclprgilglrasmfidyvqhiadrrle
riglkpiyhtknpfpwm

Timeline for d2ania_:

• d2ania_ is new in SCOPe 2.03-stable
  
• d2ania_ appears in SCOPe 2.04
  
• d2ania_ appears in the current release, SCOPe 2.08