| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (12 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries) |
| Domain d2ak1l2: 2ak1 L:108-211 [203476] Other proteins in same PDB: d2ak1l1 automated match to d1f3dj2 complexed with bez, zn |
PDB Entry: 2ak1 (more details), 1.85 Å
SCOPe Domain Sequences for d2ak1l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ak1l2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d2ak1l2: