Lineage for d2ajzl1 (2ajz L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (30 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760584Domain d2ajzl1: 2ajz L:1-107 [203473]
    Other proteins in same PDB: d2ajza2, d2ajzb_, d2ajzh_, d2ajzl2
    automated match to d1f3dj1
    complexed with ecg

Details for d2ajzl1

PDB Entry: 2ajz (more details), 2.3 Å

PDB Description: crystal structure of cocaine catalytic antibody 7a1 fab' in complex with ecgonine methyl ester
PDB Compounds: (L:) Antibody 7A1 Fab'

SCOPe Domain Sequences for d2ajzl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ajzl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divitqdelsnpvtsgesvsiscrssrsllykdgrtylnwflqrpgqspqlliylmstra
sgvsdrfsgsgsgtdftleisrvkaedvgvyycqqfveypftfgsgtkleik

SCOPe Domain Coordinates for d2ajzl1:

Click to download the PDB-style file with coordinates for d2ajzl1.
(The format of our PDB-style files is described here.)

Timeline for d2ajzl1: