SCOPe 2.08: Domain d2ajza1: 2ajz A:1-107

Lineage for d2ajza1 (2ajz A:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2ajza1: 2ajz A:1-107 [203471]
   Other proteins in same PDB: d2ajza2, d2ajzb_, d2ajzh_, d2ajzl2
   automated match to d1f3dj1
   complexed with ecg

Details for d2ajza1

PDB Entry: 2ajz, 2.3 Å

PDB Description: crystal structure of cocaine catalytic antibody 7a1 fab' in complex with ecgonine methyl ester

PDB Compounds: (A:) Antibody 7A1 Fab'

SCOPe Domain Sequences for d2ajza1:

Sequence; same for both SEQRES and ATOM records:

>d2ajza1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divitqdelsnpvtsgesvsiscrssrsllykdgrtylnwflqrpgqspqlliylmstra
sgvsdrfsgsgsgtdftleisrvkaedvgvyycqqfveypftfgsgtkleik

Timeline for d2ajza1:

• d2ajza1 first appeared in SCOPe 2.03
  
• d2ajza1 appears in SCOPe 2.07