Lineage for d2ajvl1 (2ajv L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759487Domain d2ajvl1: 2ajv L:1-107 [203465]
    Other proteins in same PDB: d2ajvh_, d2ajvl2
    automated match to d1f3dj1
    complexed with coc

Details for d2ajvl1

PDB Entry: 2ajv (more details), 1.5 Å

PDB Description: Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
PDB Compounds: (L:) Antibody 7A1 Fab'

SCOPe Domain Sequences for d2ajvl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ajvl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divitqdelsnpvtsgesvsiscrssrsllykdgrtylnwflqrpgqspqlliylmstra
sgvsdrfsgsgsgtdftleisrvkaedvgvyycqqfveypftfgsgtkleik

SCOPe Domain Coordinates for d2ajvl1:

Click to download the PDB-style file with coordinates for d2ajvl1.
(The format of our PDB-style files is described here.)

Timeline for d2ajvl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ajvl2
View in 3D
Domains from other chains:
(mouse over for more information)
d2ajvh_