Lineage for d2ajsl2 (2ajs L:108-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752492Domain d2ajsl2: 2ajs L:108-211 [203462]
    Other proteins in same PDB: d2ajsh_, d2ajsl1
    automated match to d1f3dj2
    complexed with gol, p33, so4

Details for d2ajsl2

PDB Entry: 2ajs (more details), 1.7 Å

PDB Description: crystal structure of cocaine catalytic antibody 7a1 fab' in complex with heptaethylene glycol
PDB Compounds: (L:) Antibody 7A1 Fab'

SCOPe Domain Sequences for d2ajsl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ajsl2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d2ajsl2:

Click to download the PDB-style file with coordinates for d2ajsl2.
(The format of our PDB-style files is described here.)

Timeline for d2ajsl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ajsl1
View in 3D
Domains from other chains:
(mouse over for more information)
d2ajsh_