Lineage for d2aj3e1 (2aj3 E:2-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755079Domain d2aj3e1: 2aj3 E:2-107 [203459]
    Other proteins in same PDB: d2aj3a2, d2aj3c2, d2aj3e2
    automated match to d1rhha1
    complexed with so4

Details for d2aj3e1

PDB Entry: 2aj3 (more details), 2.03 Å

PDB Description: Crystal Structure of a Cross-Reactive HIV-1 Neutralizing CD4-Binding Site Antibody Fab m18
PDB Compounds: (E:) Fab m18, Light Chain

SCOPe Domain Sequences for d2aj3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aj3e1 b.1.1.0 (E:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqmtqspsflsasvgdrvsitcrasqdiqkflawyqltpgdapkllmysastlqsgvpsr
fsgsgsgteftltisglqpedfatyycqhlkrypytfgqgtkleis

SCOPe Domain Coordinates for d2aj3e1:

Click to download the PDB-style file with coordinates for d2aj3e1.
(The format of our PDB-style files is described here.)

Timeline for d2aj3e1: