SCOPe 2.03: Domain d2ahea1: 2ahe A:16-102

Lineage for d2ahea1 (2ahe A:16-102)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (58 PDB entries)

8. Domain d2ahea1: 2ahe A:16-102 [203453]
   Other proteins in same PDB: d2ahea2
   automated match to d1k0ma2

Details for d2ahea1

PDB Entry: 2ahe, 1.8 Å

PDB Description: Crystal structure of a soluble form of CLIC4. intercellular chloride ion channel

PDB Compounds: (A:) Chloride intracellular channel protein 4

SCOPe Domain Sequences for d2ahea1:

Sequence; same for both SEQRES and ATOM records:

>d2ahea1 c.47.1.0 (A:16-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eplielfvkagsdgesigncpfsqrlfmilwlkgvvfsvttvdlkrkpadlqnlapgthp
pfitfnsevktdvnkieefleevlcpp

Timeline for d2ahea1:

• d2ahea1 is new in SCOPe 2.03-stable
  
• d2ahea1 appears in SCOPe 2.04
  
• d2ahea1 appears in the current release, SCOPe 2.08