Lineage for d2agvb4 (2agv B:361-599)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613347Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. 2613348Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 2613349Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)
  6. 2613350Protein Calcium ATPase [81658] (1 species)
  7. 2613351Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (43 PDB entries)
    Uniprot P04191
  8. 2613366Domain d2agvb4: 2agv B:361-599 [203452]
    Other proteins in same PDB: d2agva1, d2agva2, d2agva3, d2agvb1, d2agvb2, d2agvb3
    automated match to d1wpga3
    complexed with bhq, na, pty, tg1

Details for d2agvb4

PDB Entry: 2agv (more details), 2.4 Å

PDB Description: crystal structure of the sr ca2+-atpase with bhq and tg
PDB Compounds: (B:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d2agvb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2agvb4 d.220.1.1 (B:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

SCOPe Domain Coordinates for d2agvb4:

Click to download the PDB-style file with coordinates for d2agvb4.
(The format of our PDB-style files is described here.)

Timeline for d2agvb4: