Lineage for d2agvb1 (2agv B:1-124,B:240-343,B:751-994)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255902Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 2255903Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family) (S)
  5. 2255904Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins)
  6. 2255905Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 2255906Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (43 PDB entries)
    Uniprot P04191
  8. 2255921Domain d2agvb1: 2agv B:1-124,B:240-343,B:751-994 [203449]
    Other proteins in same PDB: d2agva2, d2agva3, d2agva4, d2agvb2, d2agvb3, d2agvb4
    automated match to d1wpga4
    complexed with bhq, na, pty, tg1

Details for d2agvb1

PDB Entry: 2agv (more details), 2.4 Å

PDB Description: crystal structure of the sr ca2+-atpase with bhq and tg
PDB Compounds: (B:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d2agvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2agvb1 f.33.1.1 (B:1-124,B:240-343,B:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOPe Domain Coordinates for d2agvb1:

Click to download the PDB-style file with coordinates for d2agvb1.
(The format of our PDB-style files is described here.)

Timeline for d2agvb1: