Lineage for d2ac3a_ (2ac3 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1436359Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1436360Protein automated matches [190417] (18 species)
    not a true protein
  7. 1436481Species Human (Homo sapiens) [TaxId:9606] [187294] (314 PDB entries)
  8. 1436687Domain d2ac3a_: 2ac3 A: [203437]
    automated match to d4gcja_
    complexed with zn

Details for d2ac3a_

PDB Entry: 2ac3 (more details), 2.1 Å

PDB Description: Structure of human Mnk2 Kinase Domain
PDB Compounds: (A:) MAP kinase-interacting serine/threonine kinase 2

SCOPe Domain Sequences for d2ac3a_:

Sequence, based on SEQRES records: (download)

>d2ac3a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gstdsfsgrfedvyqlqedvlgegaharvqtcinlitsqeyavkiiekqpghirsrvfre
vemlyqcqghrnvlelieffeeedrfylvfekmrggsilshihkrrhfneleasvvvqdv
asaldflhnkgiahrdlkpenilcehpnqvspvkicdfdlgsgiklngdcspistpellt
pcgsaeymapevveafseeasiydkrcdlwslgvilyillsgyppfvgrcgsdcgwdrge
acpacqnmlfesiqegkyefpdkdwahiscaakdliskllvrdakqrlsaaqvlqhpwvq

Sequence, based on observed residues (ATOM records): (download)

>d2ac3a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gstdsfsgrfedvyqlqedvlgegaharvqtcinlitsqeyavkiiekqpghirsrvfre
vemlyqcqghrnvlelieffeeedrfylvfekmrggsilshihkrrhfneleasvvvqdv
asaldflhnkgiahrdlkpenilcehpnqvspvkicdfdlgscgsaeymapevveafsee
asiydkrcdlwslgvilyillsgyppfvgrcgsdcgwacpacqnmlfesiqegkyefpdk
dwahiscaakdliskllvrdakqrlsaaqvlqhpwvq

SCOPe Domain Coordinates for d2ac3a_:

Click to download the PDB-style file with coordinates for d2ac3a_.
(The format of our PDB-style files is described here.)

Timeline for d2ac3a_: