Lineage for d2ac3a1 (2ac3 A:72-369)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. Protein automated matches [190417] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1454 PDB entries)
  8. Domain d2ac3a1: 2ac3 A:72-369 [203437]
    Other proteins in same PDB: d2ac3a2
    automated match to d4gcja_
    complexed with zn

Details for d2ac3a1

PDB Entry: 2ac3 (more details), 2.1 Å

PDB Description: Structure of human Mnk2 Kinase Domain
PDB Compounds: (A:) MAP kinase-interacting serine/threonine kinase 2

SCOPe Domain Sequences for d2ac3a1:

Sequence, based on SEQRES records: (download)

>d2ac3a1 d.144.1.0 (A:72-369) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdsfsgrfedvyqlqedvlgegaharvqtcinlitsqeyavkiiekqpghirsrvfreve
mlyqcqghrnvlelieffeeedrfylvfekmrggsilshihkrrhfneleasvvvqdvas
aldflhnkgiahrdlkpenilcehpnqvspvkicdfdlgsgiklngdcspistpelltpc
gsaeymapevveafseeasiydkrcdlwslgvilyillsgyppfvgrcgsdcgwdrgeac
pacqnmlfesiqegkyefpdkdwahiscaakdliskllvrdakqrlsaaqvlqhpwvq

Sequence, based on observed residues (ATOM records): (download)

>d2ac3a1 d.144.1.0 (A:72-369) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdsfsgrfedvyqlqedvlgegaharvqtcinlitsqeyavkiiekqpghirsrvfreve
mlyqcqghrnvlelieffeeedrfylvfekmrggsilshihkrrhfneleasvvvqdvas
aldflhnkgiahrdlkpenilcehpnqvspvkicdfdlgscgsaeymapevveafseeas
iydkrcdlwslgvilyillsgyppfvgrcgsdcgwacpacqnmlfesiqegkyefpdkdw
ahiscaakdliskllvrdakqrlsaaqvlqhpwvq

SCOPe Domain Coordinates for d2ac3a1 are not available.

Timeline for d2ac3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ac3a2