Lineage for d2ab2b_ (2ab2 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009449Domain d2ab2b_: 2ab2 B: [203436]
    automated match to d2aa6b_
    complexed with snl, so4; mutant

Details for d2ab2b_

PDB Entry: 2ab2 (more details), 1.85 Å

PDB Description: mineralocorticoid receptor double mutant with bound spironolactone
PDB Compounds: (B:) Mineralocorticoid receptor

SCOPe Domain Sequences for d2ab2b_:

Sequence, based on SEQRES records: (download)

>d2ab2b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvk
wakvlpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhq
samyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyike
lrkmvtkcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlve
iisdqlpkvesgnakplyfh

Sequence, based on observed residues (ATOM records): (download)

>d2ab2b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvpqlstisraltpspvmvleniepeivyagydsskpdtaenllstlnrlagkqmiqvvk
wakvlpgfknlpledqitliqyswmsllsfalswrsykhtnsqflyfapdlvfneekmhq
samyelcqgmhqislqfvrlqltfeeytimkvllllstipkdglksqaafeemrtnyike
lrkmvtcpnnsgqswqrfyqltklldsmhdlvsdllefcfytfreshalkvefpamlvei
isdqlpkvesgnakplyfh

SCOPe Domain Coordinates for d2ab2b_:

Click to download the PDB-style file with coordinates for d2ab2b_.
(The format of our PDB-style files is described here.)

Timeline for d2ab2b_: