SCOPe 2.07: Domain d2aa3d1: 2aa3 D:18-163

Lineage for d2aa3d1 (2aa3 D:18-163)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Plasmodium vivax [TaxId:5855] [225043] (3 PDB entries)

8. Domain d2aa3d1: 2aa3 D:18-163 [203428]
   Other proteins in same PDB: d2aa3a2, d2aa3a3, d2aa3b2, d2aa3c2, d2aa3c3, d2aa3d2
   automated match to d1t26a1
   complexed with ap0, so4

Details for d2aa3d1

PDB Entry: 2aa3, 2.05 Å

PDB Description: crystal structure of plasmodium vivax lactate dehydrogenase complex with apadh

PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2aa3d1:

Sequence; same for both SEQRES and ATOM records:

>d2aa3d1 c.2.1.5 (D:18-163) Lactate dehydrogenase {Plasmodium vivax [TaxId: 5855]}
tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
iivvtnpvdvmvqllfehsgvpknkiigl

Timeline for d2aa3d1:

• d2aa3d1 first appeared in SCOPe 2.03
  
• d2aa3d1 appears in SCOPe 2.06
  
• d2aa3d1 appears in the current release, SCOPe 2.08