Lineage for d2aa3c1 (2aa3 C:18-163)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1829377Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 1829416Protein Lactate dehydrogenase [51859] (17 species)
  7. 1829599Species Plasmodium vivax [TaxId:5855] [225043] (2 PDB entries)
  8. 1829606Domain d2aa3c1: 2aa3 C:18-163 [203426]
    Other proteins in same PDB: d2aa3a2, d2aa3b2, d2aa3c2, d2aa3d2
    automated match to d1t26a1
    complexed with ap0, so4

Details for d2aa3c1

PDB Entry: 2aa3 (more details), 2.05 Å

PDB Description: crystal structure of plasmodium vivax lactate dehydrogenase complex with apadh
PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2aa3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aa3c1 c.2.1.5 (C:18-163) Lactate dehydrogenase {Plasmodium vivax [TaxId: 5855]}
tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
iivvtnpvdvmvqllfehsgvpknkiigl

SCOPe Domain Coordinates for d2aa3c1:

Click to download the PDB-style file with coordinates for d2aa3c1.
(The format of our PDB-style files is described here.)

Timeline for d2aa3c1: