Lineage for d2a9mm_ (2a9m M:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755090Domain d2a9mm_: 2a9m M: [203421]
    Other proteins in same PDB: d2a9mh_, d2a9mi_
    automated match to d1oaql_

Details for d2a9mm_

PDB Entry: 2a9m (more details), 2.1 Å

PDB Description: Structural Analysis of a Tight-binding Fluorescein-scFv; apo form
PDB Compounds: (M:) fluorescein-scfv light chain

SCOPe Domain Sequences for d2a9mm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9mm_ b.1.1.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqpssvsaapgqkvtiscsgstsnignnyvswyqqhpgkapklmiydvskrpsgvpd
rfsgsksgnsasldisglqsedeadyycaawddslseflfgtgtkltvl

SCOPe Domain Coordinates for d2a9mm_:

Click to download the PDB-style file with coordinates for d2a9mm_.
(The format of our PDB-style files is described here.)

Timeline for d2a9mm_: