Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain [48872] (8 PDB entries) |
Domain d1hh6a1: 1hh6 A:1-107 [20342] Other proteins in same PDB: d1hh6a2, d1hh6b2 |
PDB Entry: 1hh6 (more details), 2.6 Å
SCOP Domain Sequences for d1hh6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hh6a1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-p24 (HIV-1) Fab CB 4-1 (mouse), kappa L chain} dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlk
Timeline for d1hh6a1: