Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d2a9mi_: 2a9m I: [203419] Other proteins in same PDB: d2a9ml_, d2a9mm_ automated match to d1ar1c_ |
PDB Entry: 2a9m (more details), 2.1 Å
SCOPe Domain Sequences for d2a9mi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9mi_ b.1.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvesggnlvqpggslrlscaasgftfgsfsmswvrqapggglewvaglsarsslthy adsvkgrftisrdnaknsvylqmnslrvedtavyycarrsydssgywghfysymdvwgqg tlvtvs
Timeline for d2a9mi_: