Lineage for d2a9fb2 (2a9f B:163-385)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848649Species Streptococcus pyogenes [TaxId:1314] [224997] (2 PDB entries)
  8. 2848652Domain d2a9fb2: 2a9f B:163-385 [203417]
    Other proteins in same PDB: d2a9fa1, d2a9fa3, d2a9fb1, d2a9fb3
    automated match to d1vl6a1
    complexed with mg

Details for d2a9fb2

PDB Entry: 2a9f (more details), 2.5 Å

PDB Description: crystal structure of a putative malic enzyme ((s)-malate:nad+ oxidoreductase (decarboxylating))
PDB Compounds: (B:) putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating))

SCOPe Domain Sequences for d2a9fb2:

Sequence, based on SEQRES records: (download)

>d2a9fb2 c.2.1.0 (B:163-385) automated matches {Streptococcus pyogenes [TaxId: 1314]}
dqhgtaivvlaaifnslkllkksldevsivvngggsaglsitrkllaagatkvtvvdkfg
iineqeaaqlaphhldiakvtnrefksgtledalegadifigvsapgvlkaewiskmaar
pvifamanpipeiypdealeagayivgtgrsdfpnqinnvlafpgifrgaldaraktitv
emqiaaakgiaslvpddalsttniipdafkegvaeivaksvrs

Sequence, based on observed residues (ATOM records): (download)

>d2a9fb2 c.2.1.0 (B:163-385) automated matches {Streptococcus pyogenes [TaxId: 1314]}
dqhgtaivvlaaifnslkllkksldevsivvngggsaglsitrkllaagatkvtvvdkfg
iineqeaaqlapdiakvtnrefksgtledalegadifigvsapgvlkaewiskmaarpvi
famanpipeiypdealeagayivgtgrsdfpnqinnvlafpgifrgaldaraktitvemq
iaaakgiaslvpddalsttniipdafkegvaeivaksvrs

SCOPe Domain Coordinates for d2a9fb2:

Click to download the PDB-style file with coordinates for d2a9fb2.
(The format of our PDB-style files is described here.)

Timeline for d2a9fb2: