Lineage for d2a9fa1 (2a9f A:4-162)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143051Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2143052Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2143365Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2143366Protein automated matches [226864] (29 species)
    not a true protein
  7. 2143523Species Streptococcus pyogenes [TaxId:1314] [224996] (1 PDB entry)
  8. 2143524Domain d2a9fa1: 2a9f A:4-162 [203414]
    Other proteins in same PDB: d2a9fa2, d2a9fa3, d2a9fb2, d2a9fb3
    automated match to d1vl6a2
    complexed with mg

Details for d2a9fa1

PDB Entry: 2a9f (more details), 2.5 Å

PDB Description: crystal structure of a putative malic enzyme ((s)-malate:nad+ oxidoreductase (decarboxylating))
PDB Compounds: (A:) putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating))

SCOPe Domain Sequences for d2a9fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9fa1 c.58.1.0 (A:4-162) automated matches {Streptococcus pyogenes [TaxId: 1314]}
knqlgqlaleqaktfggklevqpkvdiktkhdlsiaytpgvasvssaiakdktlaydltt
kkntvavisdgtavlglgdigpeaampvmegkaalfkafagvdaipivldtkdteeiisi
vkalaptfgginledisaprcfeieqrlikechipvfhd

SCOPe Domain Coordinates for d2a9fa1:

Click to download the PDB-style file with coordinates for d2a9fa1.
(The format of our PDB-style files is described here.)

Timeline for d2a9fa1: