SCOPe 2.03: Domain d2a9ca2: 2a9c A:344-466

Lineage for d2a9ca2 (2a9c A:344-466)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.6: Molybdenum-containing oxidoreductases-like dimerisation domain [81286] (1 protein)
   automatically mapped to Pfam PF03404

6. Protein Sulfite oxidase, C-terminal domain [49259] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [49260] (6 PDB entries)

8. Domain d2a9ca2: 2a9c A:344-466 [203411]
   Other proteins in same PDB: d2a9ca1, d2a9cb1
   automated match to d1ogpa1
   complexed with gol, mo, mte, so4; mutant

Details for d2a9ca2

PDB Entry: 2a9c, 2.5 Å

PDB Description: crystal structure of r138q mutant of recombinant chicken sulfite oxidase with the bound product, sulfate, at the active site

PDB Compounds: (A:) sulfite oxidase

SCOPe Domain Sequences for d2a9ca2:

Sequence; same for both SEQRES and ATOM records:

>d2a9ca2 b.1.18.6 (A:344-466) Sulfite oxidase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap
pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvs
vqd

Timeline for d2a9ca2:

• d2a9ca2 is new in SCOPe 2.03-stable
  
• d2a9ca2 appears in SCOPe 2.04
  
• d2a9ca2 appears in the current release, SCOPe 2.08