SCOPe 2.04: Domain d2a92c1: 2a92 C:18-163

Lineage for d2a92c1 (2a92 C:18-163)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (18 species)

7. Species Plasmodium vivax [TaxId:5855] [225043] (2 PDB entries)

8. Domain d2a92c1: 2a92 C:18-163 [203406]
   Other proteins in same PDB: d2a92a2, d2a92b2, d2a92c2, d2a92d2
   automated match to d1t26a1
   complexed with nai

Details for d2a92c1

PDB Entry: 2a92, 2.04 Å

PDB Description: crystal structure of lactate dehydrogenase from plasmodium vivax: complex with nadh

PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2a92c1:

Sequence; same for both SEQRES and ATOM records:

>d2a92c1 c.2.1.5 (C:18-163) Lactate dehydrogenase {Plasmodium vivax [TaxId: 5855]}
tpkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckv
tgsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnaf
iivvtnpvdvmvqllfehsgvpknkiigl

Timeline for d2a92c1:

• d2a92c1 first appeared in SCOPe 2.03
  
• d2a92c1 appears in SCOPe 2.05
  
• d2a92c1 appears in the current release, SCOPe 2.08