Lineage for d2a92a2 (2a92 A:164-330)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440931Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1440932Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1440933Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1440940Protein Lactate dehydrogenase [56339] (18 species)
  7. 1441078Species Plasmodium vivax [TaxId:5855] [225044] (2 PDB entries)
  8. 1441079Domain d2a92a2: 2a92 A:164-330 [203403]
    Other proteins in same PDB: d2a92a1, d2a92b1, d2a92c1, d2a92d1
    automated match to d1t26a2
    complexed with nai

Details for d2a92a2

PDB Entry: 2a92 (more details), 2.04 Å

PDB Description: crystal structure of lactate dehydrogenase from plasmodium vivax: complex with nadh
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2a92a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a92a2 d.162.1.1 (A:164-330) Lactate dehydrogenase {Plasmodium vivax [TaxId: 5855]}
ggvldtsrlkyyisqklnvcprdvnalivgahgnkmvllkryitvggiplqefinnkkit
deevegifdrtvntaleivnllaspyvapaaaiiemaesylkdikkvlvcstllegqygh
snifggtplviggtgveqvielqlnaeektkfdeavaetkrmkalih

SCOPe Domain Coordinates for d2a92a2:

Click to download the PDB-style file with coordinates for d2a92a2.
(The format of our PDB-style files is described here.)

Timeline for d2a92a2: