SCOPe 2.03: Domain d2a7pa_: 2a7p A:

Lineage for d2a7pa_ (2a7p A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein automated matches [190228] (10 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [225091] (4 PDB entries)

8. Domain d2a7pa_: 2a7p A: [203399]
   automated match to d1p4ca_
   complexed with 3il, fmn, mes; mutant

Details for d2a7pa_

PDB Entry: 2a7p, 2.2 Å

PDB Description: crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 3-indolelactate

PDB Compounds: (A:) (S)-Mandelate Dehydrogenase

SCOPe Domain Sequences for d2a7pa_:

Sequence; same for both SEQRES and ATOM records:

>d2a7pa_ c.1.4.1 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
nlfnvedyrklaqkrlpkmvydyleggaedeygvkhnrdvfqqwrfkpkrlvdvsrrslq
aevlgkrqsmplligptalngalwpkgdlalaraatkagipfvlstasnmsiedlarqcd
gdlwfqlyvihreiaqgmvlkalhtgyttlvlttdvavngyrerdlhnrfkippfltlkn
fegidlgkmdkanlemqaalmsrqmdasfnwealrwlrdlwphkllvkgllsaedadrci
aegadgvilsnhggrqldcaispmevlaqsvaktgkpvlidsgfrrgsdivkalalgaea
vllgratlyglaargetgvdevltllkadidrtlaqigcpditslspdylqne

Timeline for d2a7pa_:

• d2a7pa_ is new in SCOPe 2.03-stable
  
• d2a7pa_ appears in SCOPe 2.04
  
• d2a7pa_ appears in the current release, SCOPe 2.08