Lineage for d2a4za3 (2a4z A:525-725)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1278586Superfamily a.118.1: ARM repeat [48371] (24 families) (S)
  5. 1278747Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 1278748Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 1278749Species Human (Homo sapiens) [TaxId:9606] [48402] (19 PDB entries)
  8. 1278768Domain d2a4za3: 2a4z A:525-725 [203392]
    Other proteins in same PDB: d2a4za1, d2a4za2, d2a4za4
    automated match to d1e8ya1
    complexed with bym

Details for d2a4za3

PDB Entry: 2a4z (more details), 2.9 Å

PDB Description: crystal structure of human pi3kgamma complexed with as604850
PDB Compounds: (A:) Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit, gamma isoform

SCOPe Domain Sequences for d2a4za3:

Sequence, based on SEQRES records: (download)

>d2a4za3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d2a4za3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpiaraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
ylrgcg

SCOPe Domain Coordinates for d2a4za3:

Click to download the PDB-style file with coordinates for d2a4za3.
(The format of our PDB-style files is described here.)

Timeline for d2a4za3: