Lineage for d1cfqb1 (1cfq B:1-112)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353188Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 2353351Domain d1cfqb1: 1cfq B:1-112 [20339]
    Other proteins in same PDB: d1cfqa1, d1cfqa2, d1cfqb2
    part of anti-gp120 (HIV-1) Fab CB 4-1

Details for d1cfqb1

PDB Entry: 1cfq (more details), 2.8 Å

PDB Description: anti-p24 (hiv-1) fab fragment cb41
PDB Compounds: (B:) protein (igg2a kappa antibody cb41 (heavy chain))

SCOPe Domain Sequences for d1cfqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfqb1 b.1.1.1 (B:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qdqlqqsgaelvrpgasvklsckalgyiftdyeihwvkqtpvhglewiggihpgssgtay
nqkfkgkatltadkssttafmelssltsedsavyyctrkdywgqgtlvtvsa

SCOPe Domain Coordinates for d1cfqb1:

Click to download the PDB-style file with coordinates for d1cfqb1.
(The format of our PDB-style files is described here.)

Timeline for d1cfqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cfqb2