Lineage for d2a3pa_ (2a3p A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734491Family a.138.1.0: automated matches [227152] (1 protein)
    not a true family
  6. 2734492Protein automated matches [226857] (5 species)
    not a true protein
  7. 2734496Species Desulfovibrio desulfuricans [TaxId:207559] [225068] (2 PDB entries)
  8. 2734498Domain d2a3pa_: 2a3p A: [203389]
    automated match to d1wada_
    complexed with hec, moo

Details for d2a3pa_

PDB Entry: 2a3p (more details), 2.3 Å

PDB Description: structure of desulfovibrio desulfuricans g20 tetraheme cytochrome with bound molybdate
PDB Compounds: (A:) COG3005: Nitrate/TMAO reductases, membrane-bound tetraheme cytochrome c subunit

SCOPe Domain Sequences for d2a3pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3pa_ a.138.1.0 (A:) automated matches {Desulfovibrio desulfuricans [TaxId: 207559]}
aeapadglkmentkmpvifnhsshssyqcadchhpvdgkenlakcatagchdvfdkkdks
vhsyykiihdrkattvatcmschleaagsdkdlkkeltgckkskchp

SCOPe Domain Coordinates for d2a3pa_:

Click to download the PDB-style file with coordinates for d2a3pa_.
(The format of our PDB-style files is described here.)

Timeline for d2a3pa_: