SCOPe 2.05: Domain d2a3ma_: 2a3m A:

Lineage for d2a3ma_ (2a3m A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.0: automated matches [227152] (1 protein)
   not a true family

6. Protein automated matches [226857] (4 species)
   not a true protein

7. Species Desulfovibrio desulfuricans [TaxId:207559] [225068] (2 PDB entries)

8. Domain d2a3ma_: 2a3m A: [203388]
   automated match to d1wada_
   complexed with hem

Details for d2a3ma_

PDB Entry: 2a3m, 1.5 Å

PDB Description: structure of desulfovibrio desulfuricans g20 tetraheme cytochrome (oxidized form)

PDB Compounds: (A:) COG3005: Nitrate/TMAO reductases, membrane-bound tetraheme cytochrome c subunit

SCOPe Domain Sequences for d2a3ma_:

Sequence; same for both SEQRES and ATOM records:

>d2a3ma_ a.138.1.0 (A:) automated matches {Desulfovibrio desulfuricans [TaxId: 207559]}
aeapadglkmentkmpvifnhsshssyqcadchhpvdgkenlakcatagchdvfdkkdks
vhsyykiihdrkattvatcmschleaagsdkdlkkeltgckkskchp

Timeline for d2a3ma_:

• d2a3ma_ first appeared in SCOPe 2.03
  
• d2a3ma_ appears in SCOPe 2.04
  
• d2a3ma_ appears in SCOPe 2.06
  
• d2a3ma_ appears in the current release, SCOPe 2.08