![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.0: automated matches [227152] (1 protein) not a true family |
![]() | Protein automated matches [226857] (5 species) not a true protein |
![]() | Species Desulfovibrio desulfuricans [TaxId:207559] [225068] (2 PDB entries) |
![]() | Domain d2a3ma_: 2a3m A: [203388] automated match to d1wada_ complexed with hec |
PDB Entry: 2a3m (more details), 1.5 Å
SCOPe Domain Sequences for d2a3ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a3ma_ a.138.1.0 (A:) automated matches {Desulfovibrio desulfuricans [TaxId: 207559]} aeapadglkmentkmpvifnhsshssyqcadchhpvdgkenlakcatagchdvfdkkdks vhsyykiihdrkattvatcmschleaagsdkdlkkeltgckkskchp
Timeline for d2a3ma_: