SCOPe 2.08: Domain d1zzhd1: 1zzh D:4-169

Lineage for d1zzhd1 (1zzh D:4-169)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (26 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:1061] [225039] (1 PDB entry)

8. Domain d1zzhd1: 1zzh D:4-169 [203378]
   automated match to d1nmla1
   complexed with ca, hec, zn

Details for d1zzhd1

PDB Entry: 1zzh, 2.7 Å

PDB Description: Structure of the fully oxidized di-heme cytochrome c peroxidase from R. capsulatus

PDB Compounds: (D:) cytochrome c peroxidase

SCOPe Domain Sequences for d1zzhd1:

Sequence, based on SEQRES records:

>d1zzhd1 a.3.1.0 (D:4-169) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
alreeakglfevipmqapqladnntvtrdkidlgamlffdprmsksgvfscqschnvglg
gvdgletsighgwqkgprnaptalnavfnvaqfwdgrapdlaaqakgpvqagvemnntpe
nlvatvqsmpgyveafakafpgqkdpisfdnfalaveafeatlitp

Sequence, based on observed residues (ATOM records):

>d1zzhd1 a.3.1.0 (D:4-169) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
alreeakglfevipmqapqvtrdkidlgamlffdprmsksgvfscqschnvglggvdgle
tsighgwqkgprnaptalnavfnvaqfwdgrapdlaaqamnntpenlvatvqsmpgyvea
fakafpgqkdpisfdnfalaveafeatlitp

Timeline for d1zzhd1:

• d1zzhd1 first appeared in SCOPe 2.03
  
• d1zzhd1 appears in SCOPe 2.07