SCOPe 2.03: Domain d1zzhb2: 1zzh B:170-326

Lineage for d1zzhb2 (1zzh B:170-326)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (16 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:1061] [225039] (1 PDB entry)

8. Domain d1zzhb2: 1zzh B:170-326 [203375]
   automated match to d1nmla2
   complexed with ca, hec, zn

Details for d1zzhb2

PDB Entry: 1zzh, 2.7 Å

PDB Description: Structure of the fully oxidized di-heme cytochrome c peroxidase from R. capsulatus

PDB Compounds: (B:) cytochrome c peroxidase

SCOPe Domain Sequences for d1zzhb2:

Sequence, based on SEQRES records:

>d1zzhb2 a.3.1.0 (B:170-326) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
nskfdqwlmgadgamsadekaglklfidtgcaachnginiggngyypfgvvekpgaevlp
agdkgrfavtataddeyvfragplrnialtapyfhsgkvwdlreavsvmansqlgatldd
tqvdqitaflgtltgeqpevvhpilpvrsaqtprpeh

Sequence, based on observed residues (ATOM records):

>d1zzhb2 a.3.1.0 (B:170-326) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
nskfdqwlmgadgamsadekaglklfidtgcaachnginiggngyypfgvvekpgaevlp
dkgrfavtataddeyvfragplrnialtapyfhsgkvwdlreavsvmansqlgatlddtq
vdqitaflgtltgeqpevvhpilpvrsaqtprpeh

Timeline for d1zzhb2:

• d1zzhb2 is new in SCOPe 2.03-stable
  
• d1zzhb2 appears in SCOPe 2.04
  
• d1zzhb2 appears in the current release, SCOPe 2.08