![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (37 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187449] (23 PDB entries) |
![]() | Domain d1zy4b1: 1zy4 B:594-983 [203371] Other proteins in same PDB: d1zy4a2, d1zy4b2 automated match to d1zy5b_ complexed with gol; mutant |
PDB Entry: 1zy4 (more details), 1.95 Å
SCOPe Domain Sequences for d1zy4b1:
Sequence, based on SEQRES records: (download)
>d1zy4b1 d.144.1.0 (B:594-983) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ryasdfeeiavlgqgafgqvvkarnaldsryyaikkirhteeklstilsevmllaslnhq yvvryyaawlerrnfvkpmtavkkkstlfiqmeycengtlydlihsenlnqqrdeywrlf rqilealsyihsqgiihrdlkpmnifidesrnvkigdfglaknvhrsldilkldsqnlpg ssdnltsaigtamyvatevldgtghynekidmyslgiiffemiypfstgmervnilkklr svsiefppdfddnkmkvekkiirllidhdpnkrpgartllnsgwlpv
>d1zy4b1 d.144.1.0 (B:594-983) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ryasdfeeiavlgqgafgqvvkarnaldsryyaikkirhteeklstilsevmllaslnhq yvvryyaawlerrnfvkkstlfiqmeycengtlydlihsenlnqqrdeywrlfrqileal syihsqgiihrdlkpmnifidesrnvkigdfgligtamyvatevlynekidmyslgiiff emiypfstgmervnilkklrsvsiefppdfddnkmkvekkiirllidhdpnkrpgartll nsgwlpv
Timeline for d1zy4b1: