Lineage for d1zy4a1 (1zy4 A:594-996)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (29 species)
    not a true protein
  7. 2546284Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187449] (22 PDB entries)
  8. 2546292Domain d1zy4a1: 1zy4 A:594-996 [203370]
    Other proteins in same PDB: d1zy4a2, d1zy4b2
    automated match to d1zy5b_
    complexed with gol; mutant

Details for d1zy4a1

PDB Entry: 1zy4 (more details), 1.95 Å

PDB Description: crystal structure of eif2alpha protein kinase gcn2: r794g hyperactivating mutant in apo form.
PDB Compounds: (A:) Serine/threonine-protein kinase GCN2

SCOPe Domain Sequences for d1zy4a1:

Sequence, based on SEQRES records: (download)

>d1zy4a1 d.144.1.0 (A:594-996) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ryasdfeeiavlgqgafgqvvkarnaldsryyaikkirhteeklstilsevmllaslnhq
yvvryyaawlerrnfvkpmtavkkkstlfiqmeycengtlydlihsenlnqqrdeywrlf
rqilealsyihsqgiihrdlkpmnifidesrnvkigdfglaknvhrsldilkldsqnlpg
ssdnltsaigtamyvatevldgtghynekidmyslgiiffemiypfstgmervnilkklr
svsiefppdfddnkmkvekkiirllidhdpnkrpgartllnsgwlpvkhqdevikealks

Sequence, based on observed residues (ATOM records): (download)

>d1zy4a1 d.144.1.0 (A:594-996) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ryasdfeeiavlgqgafgqvvkarnaldsryyaikkirhteeklstilsevmllaslnhq
yvvryyaawlerrnfvkkkstlfiqmeycengtlydlihsenlnqqrdeywrlfrqilea
lsyihsqgiihrdlkpmnifidesrnvkigdfglaknvhramyvatevldgtghynekid
myslgiiffemiypfstgmervnilkklrsvsiefppdfddnkmkvekkiirllidhdpn
krpgartllnsgwlpvkhqdevikealks

SCOPe Domain Coordinates for d1zy4a1:

Click to download the PDB-style file with coordinates for d1zy4a1.
(The format of our PDB-style files is described here.)

Timeline for d1zy4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zy4a2