Lineage for d1zxmb2 (1zxm B:266-411)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931010Species Human (Homo sapiens) [TaxId:9606] [189350] (13 PDB entries)
  8. 2931012Domain d1zxmb2: 1zxm B:266-411 [203369]
    Other proteins in same PDB: d1zxma1, d1zxmb1
    automated match to d1pvgb1
    complexed with anp, mg

Details for d1zxmb2

PDB Entry: 1zxm (more details), 1.87 Å

PDB Description: Human Topo IIa ATPase/AMP-PNP
PDB Compounds: (B:) DNA topoisomerase II, alpha isozyme

SCOPe Domain Sequences for d1zxmb2:

Sequence, based on SEQRES records: (download)

>d1zxmb2 d.14.1.0 (B:266-411) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfrsyvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrh
vdyvadqivtklvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqp
ksfgstcqlsekfikaaigcgivesi

Sequence, based on observed residues (ATOM records): (download)

>d1zxmb2 d.14.1.0 (B:266-411) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfrsyvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrh
vdyvadqivtklvdvvkkknvkahqvknhmwifvnalienptfdsqtkenmtlqpksfgs
tcqlsekfikaaigcgivesi

SCOPe Domain Coordinates for d1zxmb2:

Click to download the PDB-style file with coordinates for d1zxmb2.
(The format of our PDB-style files is described here.)

Timeline for d1zxmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zxmb1