![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
![]() | Protein automated matches [190826] (23 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189350] (13 PDB entries) |
![]() | Domain d1zxmb2: 1zxm B:266-411 [203369] Other proteins in same PDB: d1zxma1, d1zxmb1 automated match to d1pvgb1 complexed with anp, mg |
PDB Entry: 1zxm (more details), 1.87 Å
SCOPe Domain Sequences for d1zxmb2:
Sequence, based on SEQRES records: (download)
>d1zxmb2 d.14.1.0 (B:266-411) automated matches {Human (Homo sapiens) [TaxId: 9606]} gfrsyvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrh vdyvadqivtklvdvvkkknkggvavkahqvknhmwifvnalienptfdsqtkenmtlqp ksfgstcqlsekfikaaigcgivesi
>d1zxmb2 d.14.1.0 (B:266-411) automated matches {Human (Homo sapiens) [TaxId: 9606]} gfrsyvdmylkdkldetgnslkviheqvnhrwevcltmsekgfqqisfvnsiatskggrh vdyvadqivtklvdvvkkknvkahqvknhmwifvnalienptfdsqtkenmtlqpksfgs tcqlsekfikaaigcgivesi
Timeline for d1zxmb2: