Lineage for d1zv4x_ (1zv4 X:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741165Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 1741166Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 1741227Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 1741228Protein automated matches [190464] (2 species)
    not a true protein
  7. 1741232Species Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries)
  8. 1741247Domain d1zv4x_: 1zv4 X: [203365]
    automated match to d2a72a_

Details for d1zv4x_

PDB Entry: 1zv4 (more details), 2.4 Å

PDB Description: Structure of the Regulator of G-Protein Signaling 17 (RGSZ2)
PDB Compounds: (X:) Regulator of G-protein signaling 17

SCOPe Domain Sequences for d1zv4x_:

Sequence, based on SEQRES records: (download)

>d1zv4x_ a.91.1.0 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyfqsmnptaeevlswsqnfdkmmkapagrnlfreflrteyseenllfwlacedlkkeqn
kkvieekarmiyedyisilspkevsldsrvrevinrnlldpnphmyedaqlqiytlmhrd
sfprflnsqiyksfvesta

Sequence, based on observed residues (ATOM records): (download)

>d1zv4x_ a.91.1.0 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyfqsmnptaeevlswsqnfdkmmkapagrnlfreflrteyseenllfwlacedlkkeqn
kkvieekarmiyedyisilpkevsldsrvrevinrnlldpnphmyedaqlqiytlmhrds
fprflnsqiyksfvesta

SCOPe Domain Coordinates for d1zv4x_:

Click to download the PDB-style file with coordinates for d1zv4x_.
(The format of our PDB-style files is described here.)

Timeline for d1zv4x_: