SCOPe 2.04: Domain d1zv4x_: 1zv4 X:

Lineage for d1zv4x_ (1zv4 X:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries)

8. Domain d1zv4x_: 1zv4 X: [203365]
   automated match to d2a72a_

Details for d1zv4x_

PDB Entry: 1zv4, 2.4 Å

PDB Description: Structure of the Regulator of G-Protein Signaling 17 (RGSZ2)

PDB Compounds: (X:) Regulator of G-protein signaling 17

SCOPe Domain Sequences for d1zv4x_:

Sequence, based on SEQRES records:

>d1zv4x_ a.91.1.0 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyfqsmnptaeevlswsqnfdkmmkapagrnlfreflrteyseenllfwlacedlkkeqn
kkvieekarmiyedyisilspkevsldsrvrevinrnlldpnphmyedaqlqiytlmhrd
sfprflnsqiyksfvesta

Sequence, based on observed residues (ATOM records):

>d1zv4x_ a.91.1.0 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyfqsmnptaeevlswsqnfdkmmkapagrnlfreflrteyseenllfwlacedlkkeqn
kkvieekarmiyedyisilpkevsldsrvrevinrnlldpnphmyedaqlqiytlmhrds
fprflnsqiyksfvesta

Timeline for d1zv4x_:

• d1zv4x_ first appeared in SCOPe 2.03
  
• d1zv4x_ appears in SCOPe 2.05
  
• d1zv4x_ appears in the current release, SCOPe 2.08, called d1zv4x1