Lineage for d1zv4x1 (1zv4 X:72-204)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002317Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2002318Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2002379Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2002380Protein automated matches [190464] (3 species)
    not a true protein
  7. 2002384Species Human (Homo sapiens) [TaxId:9606] [187381] (30 PDB entries)
  8. 2002399Domain d1zv4x1: 1zv4 X:72-204 [203365]
    Other proteins in same PDB: d1zv4x2
    automated match to d2a72a_

Details for d1zv4x1

PDB Entry: 1zv4 (more details), 2.4 Å

PDB Description: Structure of the Regulator of G-Protein Signaling 17 (RGSZ2)
PDB Compounds: (X:) Regulator of G-protein signaling 17

SCOPe Domain Sequences for d1zv4x1:

Sequence, based on SEQRES records: (download)

>d1zv4x1 a.91.1.0 (X:72-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nptaeevlswsqnfdkmmkapagrnlfreflrteyseenllfwlacedlkkeqnkkviee
karmiyedyisilspkevsldsrvrevinrnlldpnphmyedaqlqiytlmhrdsfprfl
nsqiyksfvesta

Sequence, based on observed residues (ATOM records): (download)

>d1zv4x1 a.91.1.0 (X:72-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nptaeevlswsqnfdkmmkapagrnlfreflrteyseenllfwlacedlkkeqnkkviee
karmiyedyisilpkevsldsrvrevinrnlldpnphmyedaqlqiytlmhrdsfprfln
sqiyksfvesta

SCOPe Domain Coordinates for d1zv4x1:

Click to download the PDB-style file with coordinates for d1zv4x1.
(The format of our PDB-style files is described here.)

Timeline for d1zv4x1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zv4x2