SCOPe 2.08: Domain d1zv4x1: 1zv4 X:72-204

Lineage for d1zv4x1 (1zv4 X:72-204)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)

8. Domain d1zv4x1: 1zv4 X:72-204 [203365]
   Other proteins in same PDB: d1zv4x2
   automated match to d2a72a_

Details for d1zv4x1

PDB Entry: 1zv4, 2.4 Å

PDB Description: Structure of the Regulator of G-Protein Signaling 17 (RGSZ2)

PDB Compounds: (X:) Regulator of G-protein signaling 17

SCOPe Domain Sequences for d1zv4x1:

Sequence, based on SEQRES records:

>d1zv4x1 a.91.1.0 (X:72-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nptaeevlswsqnfdkmmkapagrnlfreflrteyseenllfwlacedlkkeqnkkviee
karmiyedyisilspkevsldsrvrevinrnlldpnphmyedaqlqiytlmhrdsfprfl
nsqiyksfvesta

Sequence, based on observed residues (ATOM records):

>d1zv4x1 a.91.1.0 (X:72-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nptaeevlswsqnfdkmmkapagrnlfreflrteyseenllfwlacedlkkeqnkkviee
karmiyedyisilpkevsldsrvrevinrnlldpnphmyedaqlqiytlmhrdsfprfln
sqiyksfvesta

Timeline for d1zv4x1:

• d1zv4x1 first appeared in SCOPe 2.03, called d1zv4x_
  
• d1zv4x1 appears in SCOPe 2.07